Базируется в ЕС·Отправка из Франции·Бесплатная доставка от 150 €·Большинство заказов отправляем в течение 1 рабочего дня·Только для исследовательских целей·
Compound Profiles

Tesamorelin: GHRH Analog, Stability, and Handling

Tesamorelin is the only growth-hormone-releasing hormone (GHRH) analog to clear a phase 3 program and reach the market, sold as Egrifta since its 2010 FDA approval. At the molecular level it is the full 44-residue human GHRH sequence carrying one engineering change: a short lipid cap on the N-terminus that blocks the enzyme responsible for inactivating native GHRH. This article covers what the molecule is, how that cap works, how it compares to the CJC-1295 analogs, and the stability and handling factors specific to a 44-mer with a single oxidation-sensitive residue.

Structural identity

  • Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 amino acids), carrying an N-terminal trans-3-hexenoyl group on tyrosine 1.
  • Molecular formula: C221H366N72O67S
  • Average mass: ≈5135.8 g/mol
  • Origin: A synthetic analog of human GHRH — also written GRF(1-44) — developed as TH9507 by Theratechnologies. The native hormone is a hypothalamic peptide; tesamorelin is made by solid-phase synthesis, not biological extraction.
TESAMORELIN · GHRH(1-44) ANALOG · DOMAIN MAP trans-3-hexenoyl N-terminal cap N receptor-active 1-29 core DPP-4 site (cap-blocked) M27 oxidation C 1 10 20 30 40 44 Position (N → C)
Figure 1Domain map of tesamorelin. The full 44-residue human GHRH sequence carries a single engineered feature — the trans-3-hexenoyl cap on tyrosine 1, which shields the DPP-4 cleavage site between Ala2 and Asp3. The receptor-activating pharmacophore lives in the 1-29 core (the same span marketed separately as sermorelin). One methionine at position 27 is the molecule's only oxidation-sensitive residue.

The sequence contains no cysteine and no tryptophan, so disulfide chemistry and tryptophan photolysis are not in play. Two tyrosines (positions 1 and 10) give it moderate light sensitivity, and the single methionine at position 27 is the one residue that oxidizes under air exposure. Everything distinctive about how tesamorelin behaves in a vial traces back to the N-terminal cap and to that lone methionine.

What the N-terminal hexenoyl cap actually does

Native human GHRH has a plasma half-life measured in minutes. The reason is dipeptidyl peptidase IV (DPP-4), a serine protease that cleaves the Ala2–Asp3 bond at the N-terminus, snips off the Tyr-Ala dipeptide, and leaves the inactive GHRH(3-44) fragment behind. Lose those first two residues and the peptide can no longer activate its pituitary receptor.

Tesamorelin defeats that cleavage by attaching a trans-3-hexenoyl group — a six-carbon unsaturated acyl chain — to the α-amino group of tyrosine 1. The cap occupies the exact N-terminal real estate that DPP-4 has to dock against, and the enzyme can no longer make the cut. The result is a molecule that keeps the full GHRH(1-44) sequence and its native receptor affinity while resisting the protease that inactivates the parent hormone.

Two routes to the same goal. Tesamorelin and the CJC-1295 family both exist to survive DPP-4, but they take opposite engineering paths. CJC-1295 substitutes backbone residues — most importantly a D-alanine at position 2 — so the enzyme can no longer recognize the cleavage motif. Tesamorelin leaves the backbone alone and instead caps the N-terminus with a lipid group. Same enzyme, same problem, two different chemical defenses, and two very different molecules as a consequence. A third route shows up in the incretin agonists: the GLP-3 RT triple agonist swaps in non-natural Aib residues at the cleavage site to block the very same protease.

How is tesamorelin different from CJC-1295?

Both are growth-hormone-releasing hormone analogs, but tesamorelin keeps the full 44-residue GHRH sequence and blocks degradation with an N-terminal lipid cap, while CJC-1295 truncates to the 29-residue core and substitutes four backbone residues. Tesamorelin is the only member of the family with a completed phase 3 program and a standing FDA approval.

The GHRH-analog family is best understood as a spectrum of stabilization strategies layered onto the same hypothalamic peptide:

AnalogSequence basisStabilizing modificationApprox. plasma half-life
Sermorelin (GRF 1-29) GHRH(1-29), native None ~minutes
CJC-1295 without DAC (mod GRF 1-29) GHRH(1-29) Four backbone substitutions ~30 minutes
Tesamorelin GHRH(1-44), full length N-terminal trans-3-hexenoyl cap ~26–38 minutes
CJC-1295 with DAC GHRH(1-29) Four substitutions + albumin-binding DAC linker ~6–8 days

The deep dive on the two CJC forms — and why the albumin-tethered DAC version occupies a completely different pharmacokinetic regime — is in our CJC-1295 with DAC vs without DAC article. The single most important contrast for experimental design is sequence length: tesamorelin retains residues 30–44, which the GRF(1-29)-based analogs discard. Those residues contribute to receptor affinity and to the molecule's behavior in solution, and they are the reason tesamorelin cannot be treated as a long-acting stand-in for modified GRF(1-29).

Published research scope

Tesamorelin has more controlled human data behind it than any other research peptide in this catalog, almost all of it from a single clinical program. The development history is the fastest way to orient the literature:

  • Phase 3 program (2007–2010). Falutz and colleagues reported the pivotal trials in The New England Journal of Medicine (2007) and follow-up papers, measuring visceral adipose tissue by CT in participants with HIV-associated lipodystrophy. The program characterized reductions in visceral fat alongside elevated insulin-like growth factor 1 (IGF-1), the downstream biomarker of GH-axis stimulation.
  • FDA approval (November 2010). Approved as Egrifta for the reduction of excess abdominal fat in HIV-associated lipodystrophy. After sermorelin (GRF 1-29, marketed as Geref) was discontinued, tesamorelin became the only GHRH analog holding a current approval as a finished drug product.
  • Hepatic-fat research. Stanley and colleagues extended the work to liver fat in HIV (The Lancet HIV, 2019), reporting reduced hepatic fat fraction and effects on fibrosis markers in a controlled setting.
  • Cognition in older adults. A separate research line (Baker, Friedman, and colleagues, Archives of Neurology, 2012) examined GHRH administration and cognitive endpoints in healthy older adults and in mild cognitive impairment, independent of the lipodystrophy program.

Because tesamorelin stimulates the body's own pulsatile GH release rather than supplying GH directly, the published work consistently tracks IGF-1 as the readout. The mechanism preserves the pituitary feedback loop, which is the conceptual distinction researchers draw between a GHRH analog and exogenous growth hormone. As with every compound in this library, the findings above are summarized observationally from the peer-reviewed record and are not treatment guidance.

Pharmacokinetics: a short half-life by design

Here is the counterintuitive part. Tesamorelin is the most clinically validated GHRH analog on the market, yet it has nearly the shortest half-life of the group — roughly 26 to 38 minutes after subcutaneous administration, depending on the population studied, with a fast time to peak. It is not a long-acting molecule.

That is deliberate. The hexenoyl cap was engineered to defeat one enzyme and to preserve the full native sequence, not to stretch exposure across days. A short, sharp rise and fall is closer to the pulsatile pattern of endogenous GHRH signaling, and continuous GHRH exposure is known to desensitize the pituitary over time. Tesamorelin and CJC-1295 with DAC therefore sit at opposite ends of the design space: a roughly half-hour pulse versus a multi-day tonic signal. In research designs these pulsatile GHRH analogs are frequently co-stimulated with a growth-hormone secretagogue such as ipamorelin, which works through the independent ghrelin-receptor pathway.

Design implication. A half-life difference of two orders of magnitude is not a dosing detail — it changes what experimental question a compound can answer. Work built around the pulsatile, full-length GHRH(1-44) profile of tesamorelin is not interchangeable with work built around an albumin-tethered, continuously-present DAC analog, even though both stimulate the same receptor.

Stability of lyophilized and reconstituted material

In the sealed, lyophilized state tesamorelin follows the standard peptide storage envelope. The N-terminal cap does not change the broad picture; cold, dry, and dark is the whole rule set.

  • Refrigerated (2–8°C): 24 months as a sealed lyophilized vial is the standard manufacturer-published spec.
  • Frozen (−20°C): 36+ months. This is the research-archive storage temperature.

Reconstituted in bacteriostatic water and refrigerated, working stocks are typically stable for 14–28 days, in line with the 28-day multi-use window for bacteriostatic water. The broader framework — the four degradation pathways, freeze-thaw, and why aliquoting matters — is covered in our storage and stability article. Two compound-specific points deserve their own treatment.

Light and the tyrosine question

Tesamorelin has two tyrosine residues and no tryptophan, which places it in the moderate band of the photosensitivity hierarchy alongside most growth-hormone secretagogues. It is not as light-fragile as a tryptophan-containing compound such as MT-2, but extended exposure to fluorescent lab lighting or sunlight through a window can drive slow photolytic degradation at the tyrosine residues. Foil-wrapping refrigerated vials and not leaving reconstituted material on the bench between withdrawals is sufficient.

Methionine 27: the one residue to watch

Methionine at position 27 is tesamorelin's single oxidation-prone residue, and it behaves the same way the position-6 methionine does in TB-500: prolonged air exposure converts it to methionine sulfoxide, adding 16 Da and producing a structurally distinct species. Keep vials sealed until use — lyophilized vials ship under inert headspace that protects the methionine only until the stopper is first punctured — and refrigerate promptly after reconstitution, since oxidation kinetics slow roughly two-fold per 10°C drop.

Reconstitution and handling notes

The standard reconstitution protocol applies without exception: stream bacteriostatic water against the glass wall rather than onto the lyophilized cake, swirl gently, never shake, and refrigerate immediately. Three specifics matter for a 44-mer.

  1. Aggregation is the length penalty. At 44 residues tesamorelin is long enough to form higher-order aggregates at the air-water interface, the same chemistry that drives the universal no-shaking rule. Gentle inversion only, and minimize headspace agitation across withdrawals from a multi-use vial.
  2. The lipid cap does not block dissolution. The hexenoyl group is small relative to the peptide and does not meaningfully impair aqueous solubility at the milligram-per-mL concentrations typical for research use. Slow dissolution almost always traces to the diluent stream hitting the cake and aerosolizing material onto the stopper, not to the cap.
  3. Aliquot for long studies. The combination of length-driven aggregation and the position-27 methionine makes tesamorelin more freeze-thaw sensitive than a short, robust peptide. For a 10 mg reconstituted vial intended for use over more than a few weeks, divide into single-use portions and freeze at −20°C immediately after reconstitution.

Both the 5 mg and 10 mg vials in our catalog ship cold and pair with bacteriostatic water for reconstitution.

Common analytical and handling issues

HPLC

On reverse-phase HPLC tesamorelin elutes as a single dominant peak. The hexenoyl cap makes it slightly more hydrophobic than the uncapped native GRF(1-44), so it retains marginally longer under the same gradient. A small earlier-eluting shoulder in older lots is most often the methionine sulfoxide species; the lot's release-test chromatogram is the reference, and a growing sulfoxide peak across lots from one vendor signals an upstream storage or formulation problem.

Mass spectrometry

Theoretical average mass is ≈5135.8 g/mol. On ESI-MS the molecule appears as multiply-charged ions ([M+3H]3+, [M+4H]4+, [M+5H]5+), and the deconvoluted mass should match within standard tolerances. Two diagnostic mass shifts are worth knowing: the hexenoyl cap adds ≈96 Da relative to unmodified GRF(1-44), and each oxidized methionine adds 16 Da. A product sold as tesamorelin whose observed mass matches uncapped GRF(1-44) is a paperwork — or material — mismatch worth a question to the vendor.

Salt form and net peptide content

Tesamorelin acetate is the salt used in the approved drug product; research material is frequently supplied as the trifluoroacetate (TFA) salt, the default output of TFA-based synthesis cleavage. The counter-ion is removed for the net peptide content calculation on the CoA, so a vial labeled "5 mg" holds somewhat less than 5 mg of net peptide. Confirm the value on the lot's certificate rather than assuming the label weight — our CoA reading guide walks through where net peptide content appears, and every lot we release publishes its report in the open CoA library.

Common errors to avoid:

  • Treating tesamorelin as a long-acting analog. Its half-life is roughly half an hour. It is a pulsatile-profile tool, not an albumin-tethered one.
  • Shaking the vial to speed dissolution. A 44-mer aggregates readily at the air-water interface. Swirl, never shake.
  • Leaving reconstituted vials at room temperature. Methionine-27 oxidation accelerates measurably above ~10°C. Refrigerate after every use.
  • Repeated freeze-thaw of one reconstituted vial. Aliquot first, thaw single portions — the single largest preventable cause of degradation in tesamorelin stocks.
  • Cross-referencing GRF(1-29) literature without flagging the sequence difference. Sermorelin and the CJC analogs are built on the 1-29 core; tesamorelin is the full 1-44. They are related research tools, not equivalents.

Where to find primary literature

PubMed indexes the bulk of the tesamorelin record. Search terms "tesamorelin-10mg", "TH9507", and "GRF(1-44)" together cover most of it; the lipodystrophy program is indexed heavily under "tesamorelin lipodystrophy". The Falutz phase 3 papers, the Stanley hepatic-fat work, and the Baker/Friedman cognition studies are the three primary entry points, and Theratechnologies' regulatory filings document the development history under the TH9507 designation. For the rest of the GHRH-analog family, the CJC-1295 comparison is the companion reference.

For Research Use Only. The information on this page is a summary of published scientific literature provided for laboratory and educational reference. Nothing here is medical advice, a treatment claim, or a dosing recommendation. The compounds discussed have not been evaluated by EMA and are not intended to diagnose, treat, cure, or prevent any disease. See our RUO Policy.
Добавлено в корзину

Вам исполнилось 18 лет?

На сайте размещены исследовательские материалы. Войдя на сайт, вы подтверждаете, что вам не менее 18 лет, и принимаете наши Условия и положение RUO.